SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000006772 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000006772
Domain Number 1 Region: 338-646
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.04e-89
Family Protein kinases, catalytic subunit 0.0000000148
Further Details:      
 
Domain Number 2 Region: 156-283
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.55e-37
Family Synaptotagmin-like (S variant) 0.00000567
Further Details:      
 
Domain Number 3 Region: 97-153
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.49e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00013
Further Details:      
 
Domain Number 4 Region: 23-86
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000807
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000006772   Gene: ENSGMOG00000006368   Transcript: ENSGMOT00000006968
Sequence length 668
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3483:163440:181173:1 gene:ENSGMOG00000006368 transcript:ENSGMOT00000006968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADPSSDDGEAPESARGFARQGALRQKNVHEVKNHKFIARFFKQPTFCSHCTDFIRGFGK
QGFQCQAVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKVHTYSSPTFCDHCGSL
LYGLLHQGMKCDHCMMNIHKRCVANVPSLCGTDHTERRGRIYITAKMVEEALTVTVQEAR
NLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCCLNPTWNETFIFHPTASDTDKDRR
LSVEIWDWDLTSRNDFMGSLSFGISELQKQAVDGWFKLLGQEEGEYFNVPVQPEGEEGNE
ELRQKFERARVGPGKSSGGGDSSSSVCRYDSNGNQDRVKLSDFTFIMVLGKGSFGKVMLA
ERKGAEELYAIKILKKDVVIQDDDVECTMVEKRVLALSGKPPFLTHLHSCFQTMDRLYFV
MEYINGGDLMYQIQQVGKFKEPHAVFYAAEIAIGLFFLHSKGIVYRDLKLDNVMLDSEGH
IKIADFGMCKENMLDGVTTKTFCGTPDYIAPEIIAYQPYGRSVDWWAFGVLLYEMLAGQP
PFDGEDEDELFQSIMEHHVSYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAF
FRYIDWEKLENKEVQPPFKPKSCGRDAENFDRFFTRHPPVLTPPDQELIANLDQEEFNGF
SFVNCEFS
Download sequence
Identical sequences ENSGMOP00000006772 ENSGMOP00000006772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]