SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000006785 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000006785
Domain Number 1 Region: 371-507
Classification Level Classification E-value
Superfamily PH domain-like 1.84e-36
Family Third domain of FERM 0.0000123
Further Details:      
 
Domain Number 2 Region: 269-372
Classification Level Classification E-value
Superfamily Second domain of FERM 3.79e-32
Family Second domain of FERM 0.0000105
Further Details:      
 
Domain Number 3 Region: 196-269
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.31e-19
Family First domain of FERM 0.00053
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000006785
Domain Number - Region: 928-966
Classification Level Classification E-value
Superfamily Dodecin-like 0.0144
Family Dodecin-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000006785   Gene: ENSGMOG00000006351   Transcript: ENSGMOT00000006982
Sequence length 978
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2515:417022:446980:-1 gene:ENSGMOG00000006351 transcript:ENSGMOT00000006982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTEVGSETEVKEKAEETATQPDQPEKATEDNQEVANGEEEEKEKDGKGISRFLPPWLKK
QKSQGQVICFETSPTNKVISEATEEEEAPAPAPETNGHIEEVEEKEEVQSEEVKQKEAES
TSNASADTQSTAQSPGEAKSATEDVKEEEQQQQQQKKNEVEEEHRAGGDRGRQRKDEGLS
SIFQSPLRLVRRNKMKLVVCHVALLDGTDFPCEVEKRAKGQFLFFKVYEHLNLMERDYFG
LTYKDSHEQRCWLDPTKDIKRQIRSLPSDPSLLTEDITRYLLCLQLREDVASGRLPCSFV
THALLGSYTLQAEHGDYEPDQPTSGLHQQSFAPNQNKEMEEKILELHKSHRGMNPAQADT
QFLENAKKLSMYGVDLHRAKDSEGVDIMLGVCANGLLVYKDKLRINRFAWPKILKISYKR
NNYYIKIRPGESEQFESTVGFKLPNHRSAKRLWKVCVENHSFFSPPKARFLTLGSKFRYS
GRTQTQTRLASSLIDRPAPNFERTSSKRISRSLDGCGRGCVERESSGLSVFVTDTGNSCD
TCFLSREGGSENGHEPHLELHSDSKSPMRVHGQNIYVRHSNLMLEDHDKTQEDVLRHQAS
ISQLKRSFMEAPPPSPPQPNQWEKRFSSSPAATLRAQHEIEETHVIQEVSKETKPATVTV
TVSPSPDAPEGVALQPEVREQEVVVVVEEASDTATRARQESVSSESESDEEAEYQPNVPI
SHTLIPEEKEEEVEEVEREEQGEQEKGVEPAPITKETAIPSKPASAQDVERENGAEEEKG
ETDDSTEDPMMTPDEVPNGHALPEEEAPGMAALAEEEEAKVNGESPMADSEPRPQVICCS
EPPVVKTEMVTISDTFAAQKTHITTKEVPIVHTETKTITYEAAQLDNNGEGDPGVLMTAQ
TITSESLCTTTTTHITKTLKGGLSETRIEKRIVITGDSDIDHDQALAQAIKEAKEQHPDM
SVTRVVVHKETELAEEDE
Download sequence
Identical sequences ENSGMOP00000006785 ENSGMOP00000006785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]