SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000007167 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000007167
Domain Number 1 Region: 20-291
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.94e-65
Family FCH domain 0.002
Further Details:      
 
Domain Number 2 Region: 310-350
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000276
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000007167   Gene: ENSGMOG00000006728   Transcript: ENSGMOT00000007371
Sequence length 352
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2011:48018:54356:-1 gene:ENSGMOG00000006728 transcript:ENSGMOT00000007371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMALQFKDVFWGVDFISNMGYEAIIQRLCDGRRTCKDVEELLKMRASAEEKYGKELVTIA
RKTGGIYEINTLRKSFDEVKTQIERIGLFHLHLSGMLKEEAKSMETHREQQKEQKKKLEL
LMDKVQKTKVCLFKKTMESKKSYEQRCKEADEAKQAAVKIGNAAAATATPKQTEKLQNKS
KQCREAAEEAEKQYVSNIEQLDKIRQEWELTHVTTCEAFQQMEEERITFVRNAFWIHSNQ
LSLQCVKDDECYEDLRIILEKCAIVEDNDCFMDMKRTGPNPPAPIQFENYYERQTADNGD
PAGFVGVMKGEDELSVAAGDVVVVIEQGDDGWWTVERNGRCGLVPGSYLSLE
Download sequence
Identical sequences ENSGMOP00000007167 ENSGMOP00000007167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]