SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000007218 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000007218
Domain Number 1 Region: 176-248
Classification Level Classification E-value
Superfamily Homeodomain-like 5.56e-18
Family Homeodomain 0.0000587
Further Details:      
 
Domain Number 2 Region: 54-120
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.98e-16
Family LIM domain 0.017
Further Details:      
 
Domain Number 3 Region: 22-52
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000928
Family LIM domain 0.022
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000007218
Domain Number - Region: 117-143
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00224
Family LIM domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000007218   Gene: ENSGMOG00000006786   Transcript: ENSGMOT00000007422
Sequence length 358
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2011:126346:130084:-1 gene:ENSGMOG00000006786 transcript:ENSGMOT00000007422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDILFNPFLLDDMGDHSKKKTAIAMCVGCGSQIHDQYILRVSPDLEWHAACLKCAECSQ
YLDESCTCFVREGKTYCKRDYVRLFGMKCAKCNAGFCSSDLVMRARENVYHMECFRCAVC
TRHLLPGDEFSLRDDELLCRDDHCLMLERDSTGSPVSPGHVHSRPLHISEPVSVRHPPHR
NHVHKTSEKTTRIRTVLNEKQLHTLRTCYNANPRPDALMKEQLVEMTGLSPRVIRVWFQN
KRCKDKKRTILMKQLQQQQHNDKTNLQGMTGTPMVAGSPIRHDTSVPGNPVEVQTYQPPW
KALSDFALQSDLDQPSFQHLVSFSESGSMGNSSGSDVTSLSSQLPDTPNSMVPSPVDT
Download sequence
Identical sequences ENSGMOP00000007218 ENSGMOP00000007218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]