SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000007345 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000007345
Domain Number 1 Region: 494-658
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 1.83e-67
Family A middle domain of Talin 1 0.000000448
Further Details:      
 
Domain Number 2 Region: 2291-2479
Classification Level Classification E-value
Superfamily I/LWEQ domain 7.46e-50
Family I/LWEQ domain 0.00014
Further Details:      
 
Domain Number 3 Region: 1835-1969
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.2e-46
Family VBS domain 0.0000104
Further Details:      
 
Domain Number 4 Region: 1235-1358
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 6.67e-36
Family VBS domain 0.034
Further Details:      
 
Domain Number 5 Region: 197-311
Classification Level Classification E-value
Superfamily Second domain of FERM 1.96e-31
Family Second domain of FERM 0.00000141
Further Details:      
 
Domain Number 6 Region: 664-727
Classification Level Classification E-value
Superfamily I/LWEQ domain 6.08e-26
Family I/LWEQ domain 0.00014
Further Details:      
 
Domain Number 7 Region: 312-402
Classification Level Classification E-value
Superfamily PH domain-like 3.93e-23
Family Third domain of FERM 0.0000182
Further Details:      
 
Domain Number 8 Region: 1467-1552
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000000000000157
Family I/LWEQ domain 0.0081
Further Details:      
 
Domain Number 9 Region: 777-825
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000000000000275
Family I/LWEQ domain 0.00046
Further Details:      
 
Domain Number 10 Region: 900-985
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000000000654
Family I/LWEQ domain 0.0091
Further Details:      
 
Domain Number 11 Region: 1691-1811
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000000424
Family VBS domain 0.046
Further Details:      
 
Domain Number 12 Region: 2000-2129
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000000151
Family VBS domain 0.018
Further Details:      
 
Domain Number 13 Region: 81-138
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000168
Family Ubiquitin-related 0.056
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000007345
Domain Number - Region: 1575-1656
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000188
Family VBS domain 0.054
Further Details:      
 
Domain Number - Region: 1171-1204
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000424
Family VBS domain 0.022
Further Details:      
 
Domain Number - Region: 1071-1114
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0361
Family alpha-catenin/vinculin 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000007345   Gene: ENSGMOG00000006853   Transcript: ENSGMOT00000007554
Sequence length 2537
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2011:197593:266219:-1 gene:ENSGMOG00000006853 transcript:ENSGMOT00000007554 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVALSLKICVRQCNVVKTMQFEPSTPVYDACRIIRERVPEAQSGQASDYGLFLSDEDPRK
GIWLESGRTLDYYMLRNGDVLEYKKKQRPQKIKMLDGAVKTIMVDDSKTVGELLVTICSR
IGITNYEEYSVIQELTEEKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSR
TFREQGVEESETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEF
AGIQAYIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGSEKKIFQDHKNCGEMTEIEAKVK
YVKLARSLPTYGVSFFLVKEKMKSKNKLVPRLLGITKESVMRVEEKTKDVVQEWPLTTVK
RWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEES
TMLEESVSPKNRSTILQQQFNRVGHVEHGSVALPGIIRSGSVGGPENFNLGSMPSGQQQI
TTGQMHRGHMPPLSLAQQALMGTINSSMHAVQQAQSDLGHVGDLPPLGHDLASRVWVQNK
VDESKHEIHSQVDAITAGTASVVNLTAGEPAETDFSAVGCAITTISSNLTEMSKGVRLLA
ALMDDEVGSGHKLMGAARTLAGAVSDLLRSVEPAAAEPRQTVLSAAGSIGQASGDLLRHM
GEGETDERFQDILMNLAKAVANAAAMLVLKAKNVAQVAEDTVLQNRVIAAATRCALSTSQ
LVACTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVS
QALGDLLQHVRRYASRGEPIGRYDQATDTIMNVTENIFTSMGDAXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGAAAYPDNEDQQQRLREAAE
GLRVATNAAAQNAIKKKLINRLEIASKQAAAAATQTIAAAQNAAASNKNTASHQQLVHSC
KLVADCIPQLVQGMRSSQAQPDELSAQLALIMASQSFLQPCSKMVTSAKAAVPTVTDQAA
AMQLGQCSKNLHLPGTQAHEACGPLEIDSALKTVHTLRSELQDAKMSVIDGQLRPLPGES
LGKCAQDLGSTSKAVGSSMAQLLTCAAQGNEHYTXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPGDAESQQRLAQVAKAVSHSLNNCVNCL
PGQKDVDMALRSIGEASKKLLVDTXXXXXXXXXXXQTELNHTAAELNHSAGEVVHSSRGT
SSQLAMASGKFSQDFDEFLDAGIEMAGHTQSCDDQIQVIGNLKNISMASSKLLLAAKSLS
VDPGAANAKNLLAVAARAVTESINQLITLCTQQATGQKECDNALRELEAVRGLLDNPNEP
VNELSYFDCIESVMENSKVLGESMAGISQHCKTGDVAAFGESVGVASKALCGLTEAAGQA
SYLVGVSDTNSLSGQVGLVDPIQFARANQAIQMACQNLVDPASSPSQVLSSATIVAKHTS
ALCNACRLASSKTSNPVARRQFVQSAKEVANTTANLVKTIKALDGDFSEENRNKCHVATS
PLIQAVENLSTFANNPEFASIPAQISHEGSAAQEPIVRSARCMLDSSTYLLETARSLVLN
PKDPPTWSVLAGHSRTVSDSIKSLITSIRDKAPGQRQCDYSIDNINKCIRDIEHASLAAV
DLTLPCRDDISMEALQDQLTSSVQEIGYLIDPVSTSARGEAAQLGHKVTRLASYFEPLIV
ASVGLASKLLDQQQQMTILDQSKTLSESALQMLYAAKEGGGNPKAAHTHDAISEAAQLMK
EAVEDLMVTLNEAASEGGXXXXXXXXXXXXXXXLDEGTPPDPRGSFVDYQTTMVKFSKAI
AITAQEMMTKSVACTEELGGLASQVTGEYGQLAQQGRLAAATAEPEEVGFQIKTRVQELG
HGCIHLVQKAGALQVSPTDSFSKKELIDCARAVTEKVSLVLSALQAGNRGTQACITAASA
VSGIIADLDTTIMFASAGTLNPEDDECFADHRESILKTAKALVEDTKLLVAGAASSQDRL
AQAAQSSAQTITQLTEVVKLGATSMGSDDPETQVVLINAVRDVAKALAELISATKCAAGK
PADDPSMYQLKSAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIECIKQELTVFQSKA
VPDKSTTPEEFIRMTKGITKATAKAVAAGNSTQQEDVIATANLSRKVVSDMLATCKQAAC
HSEVSEEVRHQALQYGSECTLGYIDLLEQVLQVLQRPTGEQKQQLVVHSKRVAACVTELI
QTAEAMKGSEWVDPEDPTVIAETELLGAAASIEAAAKKLEQLKPRAKPKQADESLDFEEQ
IVEAAKSIAAATSALVKSASAAQRELVAQGKVGSNLANAVDDGQWSQGLISAARMVAAAT
SNLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVRADQDSEAMRRLQGAGNAVK
RASDNLVKAAQKAAFDKADDANVVVKTRFVGGIAQIIAAQEEMLRKERELDEARKKLAQI
RQQQYKFLPSELREDHS
Download sequence
Identical sequences ENSGMOP00000007345 ENSGMOP00000007345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]