SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000008258 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000008258
Domain Number 1 Region: 17-745
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.17e-226
Family Motor proteins 0.0000000019
Further Details:      
 
Domain Number 2 Region: 2042-2150
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000194
Family Second domain of FERM 0.011
Further Details:      
 
Domain Number 3 Region: 1596-1680
Classification Level Classification E-value
Superfamily SH3-domain 0.0000239
Family SH3-domain 0.004
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000008258
Domain Number - Region: 2151-2241
Classification Level Classification E-value
Superfamily PH domain-like 0.00231
Family Third domain of FERM 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000008258   Gene: ENSGMOG00000007696   Transcript: ENSGMOT00000008492
Sequence length 2266
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4029:113158:171988:-1 gene:ENSGMOG00000007696 transcript:ENSGMOT00000008492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VYAIRSMPTIGHRARNWAQGMEDMTQMEELNENTVLMNLKKRFDQELIYTYIGSILVSVN
PYKMFNMYGTDMVQKYEGHGLGDNPPHLFAIVNLSYTSMMDAKLNQCIVISGESGSGKTE
ATKLILRYLTAIHHKRNITQQILEATPLLESFGNARTVRNDNSSRFGKFTQIYMEEGVIS
GAITSQYLLEKSRIVFQAKSERNYHIFYEMLAGLPLHEKRLLYLQEAETYYYLNQGGDCV
IEGKDDAEDFKRVLRAMEILCFTAEEQNAIYRLLSSVLHLGNVFFQTHQVEGQEVASVVS
AQEIRVVAELLQVSPDGLLKXXXXXXXDTVREKIYTPLTVESAVDARDAVAKVLYSLLFG
WLTERINGRVYPRNEALSIAILDIYGFEELXXXXXXXXXXXXXXXXXXXXXXXXXXEEYM
REQIEWLQQAFSHNQDCLDLIAAKPHGILRILDDQSGFPQATDHTFLQKCHYHHGDNPLY
ARPKMPLPEFTLKHYAGKVTYQVQKFLDKNFDSVRQDVLDLFIQSKNRMVANLFLKHSEG
VSQQRSSARSSSVVRRFQANTVSAKFQSSLQELLEKIERCKPYFVRCIKPNHHKEPGVFD
MELISTQLRYSGILETIHIRKIGYPIRMHFHTFLFRYKGLLCLEDPPATDGENCVIMLRK
LCPLKPGTFQLGVTKIFLKEELYQLLEGKRDRLLTLAAMTLQRYARMFFVRRKFVKFKRR
MMQLQAHSRGYLLRKKLALTRRYLIKLRSAVRLIVNRQRYMRDRINREVVDVTTLPVPAE
LAVLLQAASXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEPLFGML
TAPLELSLTRTDAESKQRSLDVFILILRFMGDPDLNGAQENMFGNFIIQRGLAKPSLRDE
ILAQVANQVWRNPNALNSERGWLLLSACLSAFLPSQRLAKYLLXXXXXXXXXXXXCVCQH
RLLQALQRVSAGPEHVRTYPPCLLEWTANRKRAHTVLHIHCFDGLSFLCPLHSWTTGEEL
SKDILQHRGMVEGRRGWSVLLKEPAQWVELEGSDYVLDLMSDLELPADFPKHSSYFIISA
QEPTRVRPNASXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCFPLVFPDLDRQRGMD
HYLDSLFDPVLSDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXA
IMNQQAIIMAQQMTMQAMAMVGGPVTSPPTTPITSPPMSPLLHHPPSPYGVTSPYSTYSS
FPPSPYGPHIPAPVVTTPLPPSGDVVKYSARTHDHMIPSQDIKDIIRRYDSPPPATDPLP
AEKSRPDGKFRKKQSPRDEALQILRPQIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXSRELPVETERIQTQLHQSNNQEHYTYTNVPWRLYLRKEVFYPKDSFNHPLMLEL
IFKQIVNDTLSEACVRITRDERQKMKALFVKHRVQQNMDPVDDSVKKTVVTAARETWEIY
FSRLFPASGSVGTGVQLLSVSHSGIKLLKTVKSSAAAPDYFRVLRPYTYADILFVTIPSE
NMLEFNLTNEKLILFSAKAPQVKHLIDTFITEIKQDSDYVIAERNFVTDDHSRLSFHKGD
IIRVQVMDGLEKGFSYGCVVRKKVVFLEEMKRDTQEFGWKFGAVHGRSAAFPVECVRPVA
APDFLSVPLNRTAEPRGGAGQFAVSSAVAVAVASTMAAHEIDPTLEVSLEEFPEGDTYDS
LLQDSKYDMVEFAKNFFRQGTPGKSDSLKSRGKTMSPREPSDMIKFSKTPLTQSLIEFTD
PALNRVAADLFLSVMRFMGDHPIKGLSEQEVVSTFLKLIGEFSLMKDEAYCQVLKQLTAN
TSSKPDSCQRGWRLLYILTAFHRCSEVLKPFLFKYLQHAYLSAGVLFQGIAKACEQNLKK
TFQYGGRVIPPNSMELKAMVAGRSSKRQLFLLPGGIERHQKIKTCSXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXQNVRPLNKQEYVLDIATEAEEVDSNYSFWFRRVVWTQPLKF
DNELSVSMHYNQVLPDYRKGLLNVLPRGKVSDQQFHQISKLASLQHRAKDIIFIPSIHEL
SEYIPPPLFGKQPPQQWVTMVTQHMQQVQSLSAHQARAQYLGLVSAFPMFGSSFFYIQSS
SSTSLYAPCILAVNQHGLHFLHKDTHEILHVVPLAEVQSTRTQRPTAGTSYPYVDLTLGD
MNTQRVVQLQLEQGLELCRVIAMQVENMMSLREKRLILPASEITML
Download sequence
Identical sequences ENSGMOP00000008258 ENSGMOP00000008258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]