SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000008779 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000008779
Domain Number 1 Region: 12-136
Classification Level Classification E-value
Superfamily Hormone receptor domain 1.83e-25
Family Hormone receptor domain 0.0026
Further Details:      
 
Domain Number 2 Region: 123-428
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000366
Family Rhodopsin-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000008779   Gene: ENSGMOG00000008208   Transcript: ENSGMOT00000009024
Sequence length 454
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2428:439443:473396:1 gene:ENSGMOG00000008208 transcript:ENSGMOT00000009024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQVFLHLAILTVSSIQVSPAVALDKLKEDWLQYEKECNHNNTRAPPSTAGLVCIRNFDL
YACWPDGWPNTTVGVRCPWYLPWHNEVHNGMVYLDCQHNGQWVSDKNTSECELNTPTQQF
YGQILSRFQIIYTLGYSLSLVALVLALGTLIFFRKLHCMRNNIHMNLFASFILRALSVLI
KDALMEDPGLKIRHQDRDFTRDIITPVDLLVNNETTVACRIAMVMMHFSIMANSYWLLVE
GIYLHNLLVIVVFNERNFFNIYLCIGWGAPLLFLLPWVTAKYLYENEKCWELNVNMNFWW
IIRSPILLAVVTNFLIFIHIIKILVSKLRAHQMRYTDYKFRLAKSTLSLIPLLGIHQMVF
VFVLDESSENSLILRFTKVAIDLLVTSFQGLLVAILYCFFNKEVQSEVLKNWKRWKLGRN
IEEEYRHTYSQPSHIKSGSLLNPTQRLPTHLPDI
Download sequence
Identical sequences ENSGMOP00000008779 ENSGMOP00000008779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]