SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000008835 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000008835
Domain Number 1 Region: 10-128
Classification Level Classification E-value
Superfamily Hormone receptor domain 1.7e-26
Family Hormone receptor domain 0.00093
Further Details:      
 
Domain Number 2 Region: 290-406
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000076
Family Rhodopsin-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000008835   Gene: ENSGMOG00000008261   Transcript: ENSGMOT00000009080
Sequence length 440
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2265:29272:78406:1 gene:ENSGMOG00000008261 transcript:ENSGMOT00000009080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VESDGGLSAQEQMYILYDVKLQCHLNLSNREPTNTDDWCPPGWDGLICWPQGSPGLITRV
PCPSYIYDFNHKGSAYRKCDVNGSWVFVESLNRTWANYTECLHFLQPRNEKGKENFFRRL
YVMYTVGYAVSFSSLLVAIFIIAYFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCWEQSAGNIKWIYEVPILTAI
GLNFLLFVNIVRVLATKIRETNAGRYDTRKQYRKLAKSTLVLVLVFGVHYIIFVGLPQTT
KGPSWEVRMYFELFFNSFQGFFVSIIYCYCNGEVQTEVRKTWTRWNLALDWKVPVACGPC
RYGGADGNNNHSTSSQSHLA
Download sequence
Identical sequences ENSGMOP00000008835 ENSGMOP00000008835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]