SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000009106 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000009106
Domain Number 1 Region: 9-66
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.0000000000000249
Family Hormone receptor domain 0.0035
Further Details:      
 
Domain Number 2 Region: 191-404
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000165
Family Rhodopsin-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000009106   Gene: ENSGMOG00000008506   Transcript: ENSGMOT00000009353
Sequence length 422
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3851:7906:18723:-1 gene:ENSGMOG00000008506 transcript:ENSGMOT00000009353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSCTNSLEVLKERWAIYRNQCLDHLGTTPPALVCNRTFDQYACWPDGVPGTAVNISCPWF
LPWFSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXVVVWCRSAVVMMQYSVMANNYWLLVEGLYLHSLLVTTVFSERNYFYIYLAIGWG
APLAFVLPWATVKYLYENEECWERNINMGYWWIIRCPILFAYLINFFIFIRIIQILMSKL
KAHQMRYTDYKFRLAKSTLTLIPLLGIHAILFTFVIDESVPKGSMLRLIRLFCDLLFNSF
QGLLVAILYCFVNKEVQSEMLKKWKRWKLGKDIDEEYRHTHSHTPHPKSPSKTPSNNNNN
NN
Download sequence
Identical sequences ENSGMOP00000009106 ENSGMOP00000009106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]