SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000009599 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000009599
Domain Number 1 Region: 873-1175
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.22e-80
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000398
Further Details:      
 
Domain Number 2 Region: 193-335
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-22
Family Third domain of FERM 0.0093
Further Details:      
 
Domain Number 3 Region: 112-192
Classification Level Classification E-value
Superfamily Second domain of FERM 1.7e-17
Family Second domain of FERM 0.0016
Further Details:      
 
Domain Number 4 Region: 25-107
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.16e-16
Family First domain of FERM 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000009599   Gene: ENSGMOG00000008976   Transcript: ENSGMOT00000009858
Sequence length 1179
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1673:39124:74856:1 gene:ENSGMOG00000008976 transcript:ENSGMOT00000009858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFRLKLRRRTRRYNVLSKNSFVTGIRLLDGNVIECTLSVESTGQECLEAAAQRLELRET
HYFGLWFQGKAQAPAQRWVELEKPLKKQLDKFGNEPLLIFGVMFYIPKVSRLQQEATSRY
QYYLQVKKEVLEGPLHCTVEQGIRLAGLAVQADFGNFDQFISQDFLREYVLFPVQMQPAE
AELLYIKEVEKLDGFGQEIFAAKDNYTNDIFIGVSFIGVFVKHRNGRSIMLHRWKDIGTI
GHNKTAITVEITSKDDTITFHTDDMEMSKYIARLFSARHKFYKQNNILAEPAHSPAPIRR
RPTWTHRLSLHRPQSCNFQTMHPQYGDHYQDTQSSQDSIFHDDPYYKSETSLDHQGDYGF
RNGVVPNGSMYSSPSLSSLNHSQTFVQPSPISSTLSIPGSELMRPDYIPNHRHSTIIAPS
YRPTPEYEAVMRQKRRMTPTHHDLHSQSLRSLNISNAYAYRQPEALVNSQPEMRERGPYP
GLGAPSPGPYGPQGAASSQGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXAPVQKATEPPPGVPAAYQHQKTLSNATMLIHXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXAGMNGGGLGPSISEPDLTSVKERVRKEPVKERPVSEMFSLEDSIVEREIAQ
RTLERQRMSVDSMKRPLMMAALNGLYMARMPVPESPAEDSAKTATDERCKALEQKLEEER
VFTEYEQVPKRRAEGGPATATLADNSERNRFRDVVPYEENRVELVPNKENNTGYINASHV
KVTISGEEWHYIATQGPLANTCADFWQMVWEQGVNVIAMVTGEEXXXXXXXXXXXXXLGS
KHNSATHGKFKVTTKFRTDSGCYATTGLKVKHLLSGQERTVWHLQYTDWPEHGCPEYVQG
FIXYLEEIQSVRRHTNSMLDTSKSLNPPVVVHCSAGVGRSGVVILTELMISCLEHNQGVE
VPTMLSGLRQQRMLMVQTIAQYQFVYQVLIQFLKNSRLI
Download sequence
Identical sequences ENSGMOP00000009599 ENSGMOP00000009599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]