SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000009764 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000009764
Domain Number 1 Region: 895-1194
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.86e-94
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000498
Further Details:      
 
Domain Number 2 Region: 215-357
Classification Level Classification E-value
Superfamily PH domain-like 2.15e-30
Family Third domain of FERM 0.0023
Further Details:      
 
Domain Number 3 Region: 107-217
Classification Level Classification E-value
Superfamily Second domain of FERM 9.68e-28
Family Second domain of FERM 0.00058
Further Details:      
 
Domain Number 4 Region: 23-106
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.28e-17
Family First domain of FERM 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000009764   Gene: ENSGMOG00000009123   Transcript: ENSGMOT00000010025
Sequence length 1199
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1849:72831:90049:-1 gene:ENSGMOG00000009123 transcript:ENSGMOT00000010025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLPFGLKLKRTRRYNVSSKSCLVTRIQLLNREFVEFTLSVESTGQECLEAVAQRLELRE
ITFFSLWYYNKQHQQRWIDLEKPLKKQLDKYGLEPTVYFGVVFYVPSVGQLQQEITRYQY
YLQLKKDVLEGRIPCSIEQAIRLAGLAVQADFGDFNRYDSQEFLQKFVLFPIGWIQDERV
LEEATQKVALLYQSYRGLPAPEAEMLYMQEVEKMEGYGQESYQAKDGTGTDIVLGACLDG
IFVKHKNGRPPIVFKWNEINNMSHNKSFFALELANKEESVQFQTEDMETSKYVCRMCLAR
HKFYKINKSSLQSQPTVVNPVRRRSSTRMSLPKPPFMMPPPQMHYHSNGHFTEPYTTSQX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXVYSQPEIRVEHGGAAHLQHYPFHLNSSFHSPSPYPYPADRRPVVGA
VSVPELTNVQLQQAQEYPAPNIMRTQVYRPPPPYPYAHPRPANSTPDLSRHLYVSSSNPD
LIVTRRVHHSVQTFQEDSLPVAHSLQEVSEPLLQTGPTQRYPHGAHKRNSIEIAGLGYSL
EGLRVKERAASSSAADXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXGSKRGTRAEVKKMGPLKVAALNGLSLSRLPMHDEGKDE
PENTSNDERCKVLEQRMEQGMVFTEYEQIPKRRPSGDCAIAQQPENGERNRFQDVLPYDD
TRVELVPTKENNTGYINASHIRVTVSGHEWSYIASQGPLSNTCQDFWQMVWEQGVSIIAM
VTAEEEGGREKSFRYWPRLGSRHNTVTYGRFKITTRFRTDSGCYATTGLKIKHLLSGHER
TIWHLQYTDWPDHGCPEDFKGFLTFLEEVQSVRRHTNSISDPKNAHQPVLVHCSAGVGRT
GVVLLSEIMIACLEHNEMFDVPTVLSMLRQQRMMMVQTISQYVFIYKVLIQFLRNSRLI
Download sequence
Identical sequences ENSGMOP00000009764 ENSGMOP00000009764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]