SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000010001 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000010001
Domain Number 1 Region: 201-271
Classification Level Classification E-value
Superfamily Homeodomain-like 8.13e-20
Family Homeodomain 0.0034
Further Details:      
 
Domain Number 2 Region: 80-146
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000143
Family LIM domain 0.0081
Further Details:      
 
Domain Number 3 Region: 51-78
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000054
Family LIM domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000010001
Domain Number - Region: 143-173
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0409
Family LIM domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000010001   Gene: ENSGMOG00000009361   Transcript: ENSGMOT00000010270
Sequence length 399
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1883:423731:441242:-1 gene:ENSGMOG00000009361 transcript:ENSGMOT00000010270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPTEASGGVCFPSSDHTEGRREGMKTEETQSCLQQPPSTTPFGSEYGGGGEVCAGCESP
IADRFLLRVNERSWHETCVKCSVCLSTLSGTCYCRDRLLYCKHDYPPPRLFVRKCSACLQ
VIGRSELIMRVLGQVYHLGCFSCCECERRLQRGDEFVLKEGQLLCRVDYEKEREMLAAIS
PAPTESVKSEDEDGGGGGSGGGKGGDEGKDHKRSKRPRTILTTQQRRAFKASFEVSSKPC
RKVRETLAAETGLTVRVVQVWFQNQRAKMKKIARLGAGGGPTGGADRATMTAKKDGSSTH
GMDGLLGYPSLPRQQLLALDPNIYGGEPFRHGLTPPQLTNEQLHAYESETVFHDLDSDGS
LGHLGDCLLATGVESGLLAGRVGNPIDRLYSMQNSYFTS
Download sequence
Identical sequences ENSGMOP00000010001 ENSGMOP00000010001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]