SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000010985 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000010985
Domain Number 1 Region: 18-154
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.7e-19
Family Ankyrin repeat 0.0035
Further Details:      
 
Domain Number 2 Region: 228-278
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000759
Family SOCS box-like 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000010985   Gene: ENSGMOG00000010258   Transcript: ENSGMOT00000011283
Sequence length 306
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1662:1963:5258:1 gene:ENSGMOG00000010258 transcript:ENSGMOT00000011283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HRVLEMLLPLTCPRSIKAAGQSPLHSAAAGGHARCLRLLLASGADVNYRMSARHSGNHRD
LRRSALYYAVSNGDAGCTRALLEAGARPDLDPLQCLLVAVRSGRHDLARLLLLARADANC
YFRVVSDTVFPTALQYALKDAAMMRLLLNHGYDARSCFLCHHGDNDDQGGHAPGQSQRLR
RFCEFMGLCCLVHLSGLVVRTLLDYVGQVSLCPPLRSLLQGQGAWADICSILRSPRSLGH
ICRLKIRRCLTLKRLNNPDVMNSDLFPPRLRDYLLYRELDPQTDLNFYIHTHAHTQQKTT
KVNSHI
Download sequence
Identical sequences ENSGMOP00000010985 ENSGMOP00000010985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]