SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000011722 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000011722
Domain Number 1 Region: 219-281
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 4.73e-16
Family B-box zinc-binding domain 0.0014
Further Details:      
 
Domain Number 2 Region: 592-625,659-764
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000155
Family SPRY domain 0.023
Further Details:      
 
Domain Number 3 Region: 23-69
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000906
Family RING finger domain, C3HC4 0.018
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000011722
Domain Number - Region: 513-541
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000315
Family Fibronectin type III 0.0062
Further Details:      
 
Domain Number - Region: 167-202
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00732
Family TFIIH p44 subunit cysteine-rich domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000011722   Gene: ENSGMOG00000010964   Transcript: ENSGMOT00000012038
Sequence length 787
Comment pep:novel genescaffold:gadMor1:GeneScaffold_960:335679:349416:-1 gene:ENSGMOG00000010964 transcript:ENSGMOT00000012038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAETDIKAVTQMDAWVRMSSNMKSMEQELHCPVCKEIVKQPVVLPCQHSVCLMCASEVLV
ASGYPPPELPPEPNSPATTPNTRXXXXXXXXXXXXXXXXXXXXXXXXVGTYPGRRRKEGP
PLVMMFPCVPCGKDVELGEKGLADCLRNLTLERIVERYRHTVNLGSVAVMCQFCKPPQSL
EATKGCADCRASFCNECFKLYHPWGTPRAQHEHVQPTLNFRPKVLTCPEHDQEKLQFYCR
SCQRLLCSLCKLRRVHAGHKVLPVAHAYQALKEKITKEMNYILSNQETVLTQITQLESAI
TQTEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQVTERRSLMEH
AGLMAFTQEMLKETDPPSFVQAARQTHNRLSKAIENLQCFQLAADPSFRHFQLDVSKELK
LLTELHFIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSVYVLRVRGCNKAGYGEYSEEVYLHTPP
APVLNFYLDSRWGLHADRLVVSKEQRCARSVPGLSLLQAADLALTSCHLTSDLLVGDVAI
TQGRHYWACSVEPGSYLVKVGVGLESKLQEWFHLPQDMASPRYDPDSGHDSGAEDALDSA
PPFCFLTMGMGKIYLPQNGGHHHSHHSNSAREPVANGPSPSAPAGVTYPLPPRLGVCLDF
EKGRVTFYDAHSLRPLWEGHVDCSGPVCPAFCFIGGGALQLQELVANRNADPTPVRRVTI
QPRGTNL
Download sequence
Identical sequences ENSGMOP00000011722 ENSGMOP00000011722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]