SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000011978 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000011978
Domain Number 1 Region: 2-119
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.95e-29
Family IMD domain 0.00053
Further Details:      
 
Domain Number 2 Region: 258-319
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000394
Family SH3-domain 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000011978   Gene: ENSGMOG00000011195   Transcript: ENSGMOT00000012301
Sequence length 419
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1703:27012:41685:-1 gene:ENSGMOG00000011195 transcript:ENSGMOT00000012301 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLNQLNPSLQKLVSLGNSYIQAFYVLATTSEAYFKALARIGEQALGTKSSGSIGRILIQI
AENQRKLSTEVEGVCSKFHAEVLHDMDHHTQLDQGYISDSRGRYEIEVRRQADALERRRG
EAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXGRTMKAVAAHQADPSKPTILGFQRGELVTVLVSQPRNGWLYGQAQ
NPSRQGWFPAAFVEAVDEPSKAPSGSSMRSSSSMSDLLDQSGGRSVSRGGGPAPAPPPPP
PPPPLPHRETRASTHTSHKKHPNPVADNKPELFPRGTNPFATVKLKPTTTNDKSKPKLH
Download sequence
Identical sequences ENSGMOP00000011978 ENSGMOP00000011978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]