SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000012318 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000012318
Domain Number 1 Region: 36-183
Classification Level Classification E-value
Superfamily EF-hand 5.74e-33
Family Calmodulin-like 0.00000486
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000012318   Gene: ENSGMOG00000011523   Transcript: ENSGMOT00000012646
Sequence length 185
Comment pep:novel genescaffold:gadMor1:GeneScaffold_377:625396:628657:-1 gene:ENSGMOG00000011523 transcript:ENSGMOT00000012646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPKKKEEPKPVEAPKPEPERPKTPVFDSASVKLEFTPEQIEDFKDAFQLFDRTPANEMK
ITYAQCGDLTRALGQNPTNKEIMYVLGKPKPEEMQTKMLNFDEFLPMHQHFCKGKDSGTY
EDFVEGLRVFDKEGNGTVMGAELRHVLSVMGEKLKEDEVEQLMQNQEDANGCINYEAFVK
HIMAS
Download sequence
Identical sequences ENSGMOP00000012318 ENSGMOP00000012318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]