SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000012429 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000012429
Domain Number 1 Region: 67-106
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000000116
Family SOCS box-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000012429   Gene: ENSGMOG00000011632   Transcript: ENSGMOT00000012758
Sequence length 134
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3182:372501:374512:1 gene:ENSGMOG00000011632 transcript:ENSGMOT00000012758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHYRGTFSLWCHPKFEDRCHSVVEFIERAIMHSKNGKFLYFLRSRVPGLPPTPVQLLYP
VSRFSSVKSLQHLCRFCIRQLVRIDHIQELPLPTPLIMYLRKFYYYDPEEETYPPIEEGE
GAQQHTQPGVESQT
Download sequence
Identical sequences ENSGMOP00000012429 ENSGMOP00000012429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]