SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000013135 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000013135
Domain Number 1 Region: 12-242
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.44e-76
Family BAR domain 0.0000000244
Further Details:      
 
Domain Number 2 Region: 281-345
Classification Level Classification E-value
Superfamily SH3-domain 1.02e-22
Family SH3-domain 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000013135   Gene: ENSGMOG00000012272   Transcript: ENSGMOT00000013484
Sequence length 348
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3660:1152862:1161858:-1 gene:ENSGMOG00000012272 transcript:ENSGMOT00000013484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVAGFKKQFYKASQLVSEKVGGAEGTKLDEDFKDLEKKADVTSRAVLDVITKTSEYLQP
NPSARAKLTMLNTVSKIRGQVNSPGYPQSEGLLGESMVKFGREMGDDTNFGGALLDVGES
MKRLAEVKDSLDIDVKQNFIDPLQAIADKDIKDIQHHLKKLEGRRLDLDYKKKRQGKIPD
EEFRQALEKFHESKELAEVSMHNLLETDVEQVSQLSSLVESQVQYHRQAVQILEELYEKL
GQRVTEAQSRPRREYTPKPSPPDYGEPEQASRGYAAPAANPPSYSAAEASCKALYDFEAE
NPGELSFREGDLITLTSRIDENWFEGTVQGRVGFFPNNYVEVVVPLSH
Download sequence
Identical sequences ENSGMOP00000013135 ENSGMOP00000013135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]