SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000014294 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000014294
Domain Number 1 Region: 185-319
Classification Level Classification E-value
Superfamily PH domain-like 5.53e-35
Family Third domain of FERM 0.00047
Further Details:      
 
Domain Number 2 Region: 84-184
Classification Level Classification E-value
Superfamily Second domain of FERM 5.63e-28
Family Second domain of FERM 0.00017
Further Details:      
 
Domain Number 3 Region: 3-84
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000537
Family First domain of FERM 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000014294   Gene: ENSGMOG00000013364   Transcript: ENSGMOT00000014664
Sequence length 329
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3829:680:31015:1 gene:ENSGMOG00000013364 transcript:ENSGMOT00000014664 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRLRVVFLDDSERTFEVEQKVLGGEFFNRVCGHLKLLEKEYFGLEFRHRSGNYXXXXXXX
XXXXXXXXXXXXXXXXFIVKFFPPDPGQLKRALTRYLFALQIKQDLCNGSLTCNDNSAAL
LVSHILQAELGDYTDEVDCHHLEMKHYVPNQEYLDHKIIKYHKKHRGVSPGEADVLLLEV
SRKLEMYGIRPQPAQDGEGLRINLAVTHSGVLVFQGNTKINTFSWAKIRKLSFKRKHFLI
KLHDKVGISCKDTLVFVLASRDVCKSFWKVCVEYHAFFRLPEEPSQPPKGLLTCRGSAFR
YSMSVSGRTQKQLLDCMGAREKKQTHFER
Download sequence
Identical sequences ENSGMOP00000014294 ENSGMOP00000014294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]