SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000014421 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000014421
Domain Number 1 Region: 48-104
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000144
Family HLH, helix-loop-helix DNA-binding domain 0.0028
Further Details:      
 
Domain Number 2 Region: 112-162
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000000275
Family Hairy Orange domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000014421   Gene: ENSGMOG00000013488   Transcript: ENSGMOT00000014794
Sequence length 303
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1672:81138:82573:-1 gene:ENSGMOG00000013488 transcript:ENSGMOT00000014794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRNHSFSSSDSEMDDNIEVEKDSGDENGAPDSPQGSPSPATTMQVQARKRRRGIIEKRR
RDRINNSLSELRRLVPSAFEKQGSAKLEKAEILQMTVDHLKMLHAAGGKGYFEAHVFSKD
YRSLGFRECLAETARYLGIMEGRDSSDPLRARLVSHLSSFGSQREIHNGLGHMAWSPAHI
AHPLLLQPTGRMLPSRNSSRNTQSSSSTTSSSPSSSSEVSVATRHGLTTPAESHRLLPLG
LAGHTSKSSSPLFSSLSAFPLSFSGFPLVSPTVLSPIHPHSPLATSSSVAKPYRPWGLEI
GAF
Download sequence
Identical sequences ENSGMOP00000014421 ENSGMOP00000014421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]