SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000014494 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000014494
Domain Number 1 Region: 52-280
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.84e-47
Family Ankyrin repeat 0.00036
Further Details:      
 
Domain Number 2 Region: 365-408
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000131
Family SOCS box-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000014494   Gene: ENSGMOG00000013559   Transcript: ENSGMOT00000014867
Sequence length 414
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1366:151748:155322:1 gene:ENSGMOG00000013559 transcript:ENSGMOT00000014867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAKELKARFLAALQRNDGRAVLEILYHSDLDIDTVLEVEDRNMVLASYKQGYWLPGYKLE
KSWAMGVHVCVKYNALESLLVLLQKGAAVNRKPNGKTPLHVACEVSQADCVALLLDHGAR
INSKSLSGHTALHYCITRDSVDCAKQLLLRGGKVNMPSDNNEEDTPLHRAARFGIPQLAA
LYLSSGAAVNAVNSHKETPLLTAAFWAFDQKEQLYSEDHHLVCRILLDRNADPNIPEEDK
KTALHKAAWNCDQVLMQMLLEGGADARAMDINGCAPIQYLLKVTGVRPMGVPHLCYQLLL
NHNGARVYPPQFHKVLQACHDFPEAVEILANSYERLKPTRKWRTSIPDDCYKRHQAFYDS
LFSVWSDGPRSLMHLARCSVRGALGGMCMASVPRLPLPPSVQRYLLLEPSGALY
Download sequence
Identical sequences ENSGMOP00000014494 ENSGMOP00000014494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]