SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000014628 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000014628
Domain Number 1 Region: 160-226
Classification Level Classification E-value
Superfamily Homeodomain-like 5.99e-21
Family Homeodomain 0.0029
Further Details:      
 
Domain Number 2 Region: 46-113
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000021
Family LIM domain 0.02
Further Details:      
 
Domain Number 3 Region: 17-44
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000489
Family LIM domain 0.017
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000014628
Domain Number - Region: 107-139
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.034
Family LIM domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000014628   Gene: ENSGMOG00000013688   Transcript: ENSGMOT00000015004
Sequence length 278
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2784:25918:31680:-1 gene:ENSGMOG00000013688 transcript:ENSGMOT00000015004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GASSPAAAAGLSARAAKNQCASCGMDITDRYLLKVNDLHWHAGCLQCSVCSASLRQSSSC
YIKNKEIFCKLDYFSRFGAQCAQCGRQVFASDWVRRARGSVYHLACFACFSCKRQLSTGE
EFGLVEGRVLCRSHYDIMLENLRRAAENGTGLTLEGALPSDQDGQPKPAKRARTSFTAEQ
LQVMQTQFSQDNNPDAQTLQKLAEMTGLSRRVIQVWFQNCRARHKKPPQNNGYPPMGRMA
PSLQDELHYSSFSGPDRPHLLALHGYLDDLFPRIFHIQ
Download sequence
Identical sequences ENSGMOP00000014628 ENSGMOP00000014628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]