SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000015403 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000015403
Domain Number 1 Region: 249-341
Classification Level Classification E-value
Superfamily EF-hand 2.61e-25
Family Eps15 homology domain (EH domain) 0.0000417
Further Details:      
 
Domain Number 2 Region: 116-212
Classification Level Classification E-value
Superfamily EF-hand 2.73e-25
Family Eps15 homology domain (EH domain) 0.0000163
Further Details:      
 
Domain Number 3 Region: 14-103
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000214
Family Eps15 homology domain (EH domain) 0.0000419
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000015403
Domain Number - Region: 365-477
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000366
Family Myosin rod fragments 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000015403   Gene: ENSGMOG00000014371   Transcript: ENSGMOT00000015798
Sequence length 904
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1112:1095260:1123348:1 gene:ENSGMOG00000014371 transcript:ENSGMOT00000015798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATLSLTQLSSGNPVYDKYYRQVDPAGSGRVAAADAALFLKRSGLADLVLGKVWDLADS
ERKGCLNKQQFFIALRLVACAQNGLEVALKSLHLAVPPPKFNDTSSPQLTGGGAMDIPWF
VKAEEKMKFDTIFDSLFPVGGYLTGDKVKPVLLNSKLPVDVLGRVWELSDIDRDGMLERD
EFAVAMYLVYRALEGEPVPMSLPPPLVPPSKRKKPTVPSGMPLLPSPPSTKDARSAXXXX
XXXXXXXQWVVSPADKAKYDELFSKTDGDMDGLVSGPEVRDIFLKTGLPSATLARIWELC
DIGDLGKLTREQFALALHLINQRLTKGLEPPQTLSAEMIPPSDRLSIKQQNMANLAADFS
AIKELDSLSNEIVDLQREKSGVEQEIKEKEETIQQRTSEVQELQDVVSRESLTLQQLHAE
RQRIQEAVDELDLEKSSLEGQLSHIRQQTSQESQLITSLQSEHEEQEITIGQYEEALVQA
REELLKLQEETRLLEEKVQGAREQLTPLQESVRDSFKQVTQVQQKLTELKVEDRSVTAQL
SWKRALEDSSPVLVNGSELKEEEDEEEAPEAIPRSRGKEQSEDEEEEESPVPETAEEAVE
SPERSSPPQHRTSQPRPAQPGLQGPPELGFFQSDPFTDHDPFKDDLFGKADVLXXXXXXX
XXXXXXXXXXXXXXXXXXXXXGNGHADPFSSSQPAVELPVNATPTNDPFAPGGTAVSGSG
SDPVTDPFAAVFGNESFGGGFADFSALAKSNGADAFGTNNKNIFQDDTAPTNSDVPPALP
PKTGTPTRPPPPPPGKRSSISRTESSDSFQRRGHFHPQGSGDSSSSLPAKDPPADPFAPS
SPHRHAAREPERFASFDKYPTEDDMIEWAKRESEREEKARLARLTQQEQEDLELAIALSK
SELS
Download sequence
Identical sequences ENSGMOP00000015403 ENSGMOP00000015403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]