SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000015615 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000015615
Domain Number 1 Region: 136-263
Classification Level Classification E-value
Superfamily Second domain of FERM 3.31e-26
Family Second domain of FERM 0.0036
Further Details:      
 
Domain Number 2 Region: 266-367
Classification Level Classification E-value
Superfamily PH domain-like 1.97e-21
Family Third domain of FERM 0.0089
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000015615
Domain Number - Region: 49-130
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00207
Family Ras-binding domain, RBD 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000015615   Gene: ENSGMOG00000014484   Transcript: ENSGMOT00000016011
Sequence length 404
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3633:40349:46495:-1 gene:ENSGMOG00000014484 transcript:ENSGMOT00000016011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCSLSQNPKSSIMSAEKRARLRNNPVKVRFAEEVVVNGLTQGNSLLFLPNVLKVYLENGQ
TKAFKFDNTTTVKVECVYLSKEGQHGRSLYWPRHRIEVMKMSTVPVEGEARLVDQVVQKK
DSHDYRCLFRVSFIPRDPSDLLQDDPSAFEYLFHQSVGDVLQERFAVEMKCNTALRLAAL
HMHERLASCGQTRTSIKSITKEFGLDSFISPTLLSNMREKDLRKAIGYHMKKIQALLEPR
QKVIPSPQARLAYLTQLGELISYGGRSYTATMMLQDREALVSLLVGAKYGMSQVINHKLH
MISTLVEFSSISRVELLSESDKVSLLRISLHDMKPFALLMDSLAAKDLACLLGGYCRLLV
EPTVNVFRPGRPKVRVHRIPAEEGYVSRCCSDSDDSSDEDYPME
Download sequence
Identical sequences ENSGMOP00000015615 ENSGMOP00000015615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]