SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000015775 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000015775
Domain Number 1 Region: 60-173
Classification Level Classification E-value
Superfamily PH domain-like 2.36e-17
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 2 Region: 248-293
Classification Level Classification E-value
Superfamily SH2 domain 0.000000000000114
Family SH2 domain 0.00039
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000015775
Domain Number - Region: 1-28
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00434
Family Ras-binding domain, RBD 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000015775   Gene: ENSGMOG00000014737   Transcript: ENSGMOT00000016178
Sequence length 293
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1311:445672:459939:1 gene:ENSGMOG00000014737 transcript:ENSGMOT00000016178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVLSSWGMDTESRLCFRKNYAKYEFFRTPLDFFPDHMVSVSNETNGLMDPSQLIQTFLN
SSMCPEIHGYLHAKEQARKTWKRLYFVLRRSGLYFSNKGTSKEPRHLQVLAEFRDSDVYS
LLSARKLQGAPTDFGFCLKSTESGSSRNMKMLCADDQQSRTCWITALRLLKYGLQLYQNF
LQPHQKQKASPMRSISESSLVAMDFSGQRSRVIQNPSEALCVAVEEGLSWRRKSWHRFSS
YGSPSTAAALHQTQPWFHGQLSRDEAQRLIIQQGQVDGLFLLRDSQSNPNTFV
Download sequence
Identical sequences ENSGMOP00000015775 ENSGMOP00000015775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]