SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000015946 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000015946
Domain Number 1 Region: 31-96
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000361
Family LIM domain 0.012
Further Details:      
 
Domain Number 2 Region: 170-233
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000984
Family Homeodomain 0.0042
Further Details:      
 
Domain Number 3 Region: 3-29
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000372
Family LIM domain 0.021
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000015946
Domain Number - Region: 92-122
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0323
Family LIM domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000015946   Gene: ENSGMOG00000014888   Transcript: ENSGMOT00000016354
Sequence length 403
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3493:30039:39932:1 gene:ENSGMOG00000014888 transcript:ENSGMOT00000016354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAHCAGCERPILDRFLLNVLDRAWHAKCVQCCDCSLNLTEKCFSRDGKLYCKMDFFRRF
GTKCAGCLQGISPNDLVRKARNKVFHLNCFTCMVCNKQLSTGEELYVIDENKFVCKEDYL
SSGTIKEVSLNSAVSSCTDRSLSPDLQDPIHDDIKETDNSTSSDKETNNNENEEQNSGGT
KRRGPRTTIKAKQLETLKAAFVATPKPTRHIREQLAQETGLNMRVIQEHWRQNESNRVLV
KASLGLGIIRNPIREGSRLHTAQGHALEAWREPEVESREGFISSTEYQGDYYGPGSTYDF
FPHGPPSSQAHSPAESPYILGSGPGGLEGSGPGHHPSDDQRFTDMISHAETPSPDPGLPG
SLQTVPGEAYGGGPSPPFSLASNSSYSAPMSHQGGEMGETAAW
Download sequence
Identical sequences ENSGMOP00000015946 ENSGMOP00000015946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]