SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000016068 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000016068
Domain Number 1 Region: 96-311,403-543
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.42e-93
Family Protein serine/threonine phosphatase 0.00000178
Further Details:      
 
Domain Number 2 Region: 535-687
Classification Level Classification E-value
Superfamily EF-hand 1.33e-22
Family Calmodulin-like 0.021
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000016068
Domain Number - Region: 40-87
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0863
Family IP3 receptor type 1 binding core, domain 2 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000016068   Gene: ENSGMOG00000014973   Transcript: ENSGMOT00000016478
Sequence length 698
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3749:455791:465260:-1 gene:ENSGMOG00000014973 transcript:ENSGMOT00000016478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCGMGKQHLKKRERAMRAALLIQRWYRQYVARLEMRRRCTWNIFQSIEYAGEQDQIKLY
NFFGYLMEHFTPASSERSLISHIFRENDVVHDTEWERYFCYKSIEVSHGYHGPHLTFPMT
FCEASKLVEAFKHKQLLHSRYVLQLLGEAWKLLRILPNINHVSTCHSKEITICGDLHGQL
EDLLLVFYKNGLPSSEKPYVFNGDFVDRGKSSMEILLILFAFLLVYPNGVHLNRGNHEDH
IVNLRYGFTKEVLGKYRVHGKKILKLLQKMFSWLPLATVIDGKVLVVHGGISDTTDLNVI
ARMERHKVIQYVSALRPPKSSRRSAGGNRRAAAPREDHHGTGARARPRAPDPGTPPRRSL
HSGSAVEEELRQRRQQAGLSQSCGRTKTTGSDPQPRTPERDEWKQMVDLLWSDPMAQDGC
QPNQVRGGGCYWGPDVTEEVLGRHHLQLLIRSHECKQDGYEFCHNRRVLTLFSASNYYEV
GSNRGAYVRMGPDLVPHFIQYQSSQTCRTLTLRQSIGRTERSALCALREQLFAHKSDLLG
AFQHYDPDNTGVISLKHWASAMEGVLKLGLPWRVLRSQLGTSTQDGMLDYREWIQDLVFS
EPKHELSNASILETMYRNHSNLETIFRIIDTDHSGSLSFEEFRQTWKLLSAHLKTEVDDD
AIADLALSIDFNKDGSIDINEFMEAFRLVALAVPSTRG
Download sequence
Identical sequences ENSGMOP00000016068 ENSGMOP00000016068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]