SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000016224 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000016224
Domain Number 1 Region: 88-240
Classification Level Classification E-value
Superfamily Kelch motif 2.48e-24
Family Kelch motif 0.012
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000016224
Domain Number - Region: 7-41
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0525
Family Integrin beta EGF-like domains 0.053
Further Details:      
 
Domain Number - Region: 45-75
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0978
Family Integrin beta EGF-like domains 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000016224   Gene: ENSGMOG00000015167   Transcript: ENSGMOT00000016639
Sequence length 241
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2229:177934:190528:-1 gene:ENSGMOG00000015167 transcript:ENSGMOT00000016639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SINSCPNNCSGHGRCSTANSMSGRMYCECEDYWKGEACHVPYCRQDCGSPGRGYCDLTGE
KLCVCNDSWQGPDCSLPIPSTEAFWVVPSVKPSPQSLGRASHQALVHSGLMWVVGGYSFN
YSYYHMVINYNLETSTWEAVAGGSGPLPRYGHSLALHQGDIHMFGGKLEGGPSNVTDELW
VFNILQRTWSLRQPAPPPPHAQEGHSAHLVELASGEPVMLVFFGYSPIYSYISKVQEYNL
R
Download sequence
Identical sequences ENSGMOP00000016224 ENSGMOP00000016224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]