SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000016451 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000016451
Domain Number 1 Region: 973-1264
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.91e-79
Family Protein kinases, catalytic subunit 0.000000000297
Further Details:      
 
Domain Number 2 Region: 329-488
Classification Level Classification E-value
Superfamily L domain-like 3.12e-46
Family L domain 0.00000188
Further Details:      
 
Domain Number 3 Region: 34-195
Classification Level Classification E-value
Superfamily L domain-like 1.07e-40
Family L domain 0.00000143
Further Details:      
 
Domain Number 4 Region: 485-604
Classification Level Classification E-value
Superfamily Fibronectin type III 5.4e-29
Family Fibronectin type III 0.0000258
Further Details:      
 
Domain Number 5 Region: 607-690
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000825
Family Fibronectin type III 0.00076
Further Details:      
 
Domain Number 6 Region: 798-927
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000171
Family Fibronectin type III 0.0000944
Further Details:      
 
Domain Number 7 Region: 236-338
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000138
Family Growth factor receptor domain 0.0000255
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000016451   Gene: ENSGMOG00000015335   Transcript: ENSGMOT00000016867
Sequence length 1311
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2554:258706:332221:1 gene:ENSGMOG00000015335 transcript:ENSGMOT00000016867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSQRRRSSTTLFWGLMLSVLTLLCVRPSCGEICSPSIDIRNDISELRRLENCTVVEGYL
QILLISDKTSTLNQELLRSLSLPKLTVITDYLLLFRVAGLDSLSTLFPNLSVIRGRNLFY
NYALVIFEMTSLKDIGLYNLRNVTRGAIRIEKNPELCYLDSVDWSLIMGADGNNFISGNK
QSKECGDVCPGMMEDKPLCVRTQLKEKFDYRCWTSNQCQKVCPDTCKQACSDRGECCHSQ
CLGSCSEPHSDTACSACLHYYHEGRCVAQCPPGTYKFEGWRCITMDLCSRLHLPHDNAFV
IHAGECMTDCPPGFTRNETNGMLCSACHGLCDKTCSSTIIDSVDAAQGLLGCTVIKGNLL
INIRRGNNIASELESFMGLIQTVTGYVRIRYSHTLSSLSFLKSLRYINGEELMDQMYSFS
AINNQNLQFLWDWSTHNLTVRAGRLFFQLNPKLCMSEIHKMWEKTGVPEKRKDGDVRNNG
DRASCESDTLTFKSNTTTSNSIKLTWERYRPLDYTDLISFIVYCKESPHQNITEFDGQDG
CGSNSWNMVDVELPPDKAADPQVQLKLLKPWTQYAVFVRAITLQRDDKHIKGAQSDVVYI
RTRPSQPSMPKDPRAFANSSTKLVVRWAPPVSPNGNLTFYLVRWQQQQEDRELYLHNYCS
KELKLPIRLSATGLTDLDENSKPTKSDLSGAEKGQCCMCPKTPEEKGREQDDRVFLKHFE
NFLHNSIFLPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXYRMDIHACSQEVRSCSAAAFVYSRTKPADKADDIPGPVVYEL
DEKTEGCVILHWPEPSKPNGLILMYGIKFRLGAEPEKHECVSRQQFHEHRGGRLSNLGPG
NYSARVRAISLAGNGSWTETVYFYVAPPKREYEVTLYLAVIVPLIVIIMIISLLTALFFI
NKKRNSDRLGNGVLYASVNPEYFSAAEMYVPDEWEVAREKITMNKELGQGSFGMVYEGMA
KGVVKDDPETRVAIKTVNETASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVI
MELMTRGDLKSHLRSLRKENSTTQVLPPLKKMIQMAGEIADGMAYLNANKFVHRDLAARN
CMVTEDYTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTMSDVWSFGV
VLWEIATLAEQPYQGLSNEQVLRFVMDGSLLEKPDNCPDMLFELMRMCWQYNPKMRPAFL
EIISSITADLEGPFREMSFFFSDENKPPDTEELDMEVENMENIPLDPVSSQ
Download sequence
Identical sequences ENSGMOP00000016451 ENSGMOP00000016451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]