SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000016471 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000016471
Domain Number 1 Region: 369-546
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.45e-50
Family SPRY domain 0.0014
Further Details:      
 
Domain Number 2 Region: 7-78
Classification Level Classification E-value
Superfamily RING/U-box 8.48e-18
Family RING finger domain, C3HC4 0.0083
Further Details:      
 
Domain Number 3 Region: 138-197
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000259
Family B-box zinc-binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000016471   Gene: ENSGMOG00000015374   Transcript: ENSGMOT00000016887
Sequence length 551
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3691:1545:5735:1 gene:ENSGMOG00000015374 transcript:ENSGMOT00000016887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKQFSLKDLEDELTCSICLCPFQVPVTIPCGHNFCQDCLVATWKESYDCPQCRAHFPTRP
ELKKNTVLSTVVETFKTRSSKTEFGLERKEEEAQKAHRCDTCMSSEADKTCLTCMASFCL
EHVRPHLDNPNYRAHQLREPLADMSERVCPDHHKLMEFFCVQHSRCICSFCLQQVHKGCA
FSTPDEQKALKEESVINRKKMLEAEYQQIREMLHKEEREAMNAVDRQLQSGEAKYTNVIK
RLVQNIQQMDTAKDTVSDVLSQSDTLAFLQSSVELPSVVSFECIPPRVTLDSKDVIGAQT
FVVVFKDFLCELLKKPVETRAAMLKPGEPNEKKVKAAASMENLLDFSTGAQSKGCKPEQK
STEDPGVTRHDLLKYATVLTFDRKTAHRRVKLSENLTEASVMDEPANYPDGPARFSVCSQ
VLASKGFSRGRHYWEVKMSSNNYVAIGLAYKSMDRKGPTSRLGRNDQSWCVEWLTLKLSA
WHDNSETVLASLSSKRVGVLVDCDEGTATFYSIAGAVNPFYTFSIPFVQAVYPAFWIFSN
NSSLALCKLSG
Download sequence
Identical sequences ENSGMOP00000016471 ENSGMOP00000016471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]