SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000016480 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000016480
Domain Number 1 Region: 351-523
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.1e-58
Family SPRY domain 0.0000205
Further Details:      
 
Domain Number 2 Region: 10-77
Classification Level Classification E-value
Superfamily RING/U-box 1.67e-18
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 3 Region: 135-194
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 7.48e-16
Family B-box zinc-binding domain 0.00075
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000016480
Domain Number - Region: 202-290
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0314
Family HBL-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000016480   Gene: ENSGMOG00000015395   Transcript: ENSGMOT00000016896
Sequence length 527
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1407:26595:28217:1 gene:ENSGMOG00000015395 transcript:ENSGMOT00000016896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACANTSWSEENFSCSICLDVFNSPVTTTCGHNFCRTCVRKFWDGQVRYKCPVCNKLFNT
RPDLQVNTFLSELAAQIRTTVRVKSSLVEPEEVPCDVCTGTQLKAVKSCLVCLISYCQTH
LEPHHRVAGLKKHRLVEPMERLEDRWCKKHDRLLELFCRTEQVCVCLLCTVTDHKSHPVV
PLKEEYEVKTVQLGKRGAEVPQKIQERKQKIKEIKDTVELSNKDADREIAHGGQVFTALI
GCVEKGRDEFNQTVKEKLKSTVKRAEDLIKELEQEIEDLTNRSSKVKRLSHTEDHLHFLE
TFRSLKDPPPTRDWTMVEVRPPSYVGTLRRSLDQLEETLNMEMKKLSDAELKMVQQYEVD
VTLDPDTAHPHLILSEDGKQVHHGYVWKTLPDNPKRFTKYTFVLTRQNFSSGRFYFEVQV
KDKTAWGLGVARESIDRTGGSRGTPETGYWDNPPVRLPLRAELQKVGVFVDYDEGLVSFY
DVEARVHIYSATGCTFTEPLYPLLCPCHHEEGRNSAPLIISPVNQTD
Download sequence
Identical sequences ENSGMOP00000016480 ENSGMOP00000016480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]