SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000016750 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000016750
Domain Number 1 Region: 336-464,738-911
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 4.14e-51
Family Diacylglycerol kinase-like 0.014
Further Details:      
 
Domain Number 2 Region: 1122-1189
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.71e-17
Family SAM (sterile alpha motif) domain 0.0023
Further Details:      
 
Domain Number 3 Region: 65-130
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000767
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 4 Region: 260-306
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000404
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00036
Further Details:      
 
Domain Number 5 Region: 202-233
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000366
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000016750   Gene: ENSGMOG00000015563   Transcript: ENSGMOT00000017169
Sequence length 1194
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2092:23969:54901:-1 gene:ENSGMOG00000015563 transcript:ENSGMOT00000017169 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATGWRPPPGSPVAEPRGSGGRMAEAGGPESAARSLEESSDSDPEQEHGSPQKLIRKVSTS
GQIRSKTILKEGQLMKQTTSFQRWKRRYFKLRGRTLYYAQTAKSIIFDEVDLTDASVAES
STKNVNNSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXSGVMSHGLSCEVCKFKVHKRCAVRATNNCKWTTLASVGTD
IIEDEEGVSVMPTSGWRGTPVSAKCSVCEKTCGSVLRLHDWKCLWCKAMVHSSCKEQLSI
KCPLGQCKVSVIPPTALNSIDSDGFWKASCPPSCTSPLLVCVNSKSGDNQGVKFLRRFKQ
LLNPAQVFDLMNGGPHLGLRLFQRFDTFRILVCGGDGSVGWVLSEIDTLSLHTQCQLGVL
PLGTGNDLARVLGWGAACDDDAQLPQILEKLERASTKMLDRWSIMVYETKFPRQHSSSTI
TDDYSDTEILTYEDSVAAHLSKILTSDQHSVVISSAKVLCETVKDFVARVGKAYEKNTER
SEESDAMAKKVLKEKLDSLLKTLNEESQASTPPPPPPTIAEEQEEEGGGAPPRPTPPTPA
CSPRCSSAPPAAIFKPREQLMLRANSLKKAIRQIIEHTERAVDEQNAQTQKVFSLGGAPD
EDRVSLQSHHNSKTPCEKLIMKGDSKQGPMLNTKILYPSLRAGVSGSLSSSSVISRLLVN
ADPFSCHHDNMFRDCYTEKCVMNNYFGIGLDAKISLDFNNKRDEHPEKCRSRTKNMMWYG
VLGTKELLQRTYKNLEQKVQLECDGQYIPLPSLQGIAVLNIPSYAGGTNFWGGTKEDDTF
SAPSFDDKILEVVAVFGSMQMAVSRVINLQHHRIAQCRQVKITILGDECVPVQVDGEAWL
QPPGFIRIVHKNRTQTLTRDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXFSIREIAQFHHVMEQELAHAVNASAKTMDIVYANKSSSTLSCGA
VLQMVSNVKALHSETELLLSGNMSMQLEQHQADQLNAALSSVGLQLRRLSDIAWLAPLIE
PSEHEFSGRRSLGSKFRLVPKFKKEKYNKNREACTSLSLSLPVERWGTLEVGAWLERLCL
QEYKEIFIRHDVQGAELLLLERRDLKDLGVTKVGHMKRILQGIRELTRSSTDVD
Download sequence
Identical sequences ENSGMOP00000016750 ENSGMOP00000016750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]