SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000018309 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000018309
Domain Number 1 Region: 26-165
Classification Level Classification E-value
Superfamily EF-hand 3.3e-40
Family Calmodulin-like 0.0000471
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000018309   Gene: ENSGMOG00000017050   Transcript: ENSGMOT00000018757
Sequence length 172
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2090:1763:3390:1 gene:ENSGMOG00000017050 transcript:ENSGMOT00000018757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSKRAKGKNTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
LGKNPTEDYLETMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGIIHE
DSLRELLTTMGDRFTDEDVDELFREAPIDTKGNFNYVAFTRILKHGAKDKDD
Download sequence
Identical sequences ENSGMOP00000018309 ENSGMOP00000018309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]