SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000018539 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000018539
Domain Number 1 Region: 182-251
Classification Level Classification E-value
Superfamily Homeodomain-like 8.13e-18
Family Homeodomain 0.0000577
Further Details:      
 
Domain Number 2 Region: 54-120
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.95e-16
Family LIM domain 0.016
Further Details:      
 
Domain Number 3 Region: 22-52
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000105
Family LIM domain 0.022
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000018539
Domain Number - Region: 117-144
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00665
Family LIM domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000018539   Gene: ENSGMOG00000017258   Transcript: ENSGMOT00000018994
Sequence length 361
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3816:411933:417910:1 gene:ENSGMOG00000017258 transcript:ENSGMOT00000018994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDIIFNSSFLGDMGDHSKKKPGFAMCVGCGSQIHDQYILRVSPDLEWHAACLKCAECSQ
YLDESCTCFVRDGKTYCKRDYVRLFGIKCSKCNLGFSSSDLVMRARDNVYHIECFRCSVC
SRQLLPGDEFSLRDEELLCRADHSLLVERSSAGSPVSPGHILFLNIFSPPYTEPVTVRQA
PHRNHVHKQSEKTTRVRTVLNEKQLHTLRTCYNANPRPDALMKEQLVEMTGLSPRVIRVW
FQNKRCKDKKRSILMKQLQQQHHSDKTNLQGLTGTPLVAGSPIRHEGSLQCNPVEVQTFQ
PPWKALSEFALQSDLDQPAFQQLVSFSESGSLGNSSGSDVTSLSSQLPDTPNSMVPSPVE
T
Download sequence
Identical sequences ENSGMOP00000018539 ENSGMOP00000018539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]