SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000018740 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000018740
Domain Number 1 Region: 267-421
Classification Level Classification E-value
Superfamily EF-hand 4.7e-21
Family Calmodulin-like 0.015
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000018740
Domain Number - Region: 120-253
Classification Level Classification E-value
Superfamily EF-hand 0.000135
Family Calmodulin-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000018740   Gene: ENSGMOG00000017435   Transcript: ENSGMOT00000019198
Sequence length 458
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2409:112324:119567:1 gene:ENSGMOG00000017435 transcript:ENSGMOT00000019198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANEKTTHWSDILKRRLANSTRKDERNEDEKKAEETELFTKYYSEWKAGSNRDSSYKKIP
RFYYRLPAEDEVLLQKLREESRAVFLQRKSRELLDNEELQNLWFLLDKHQVPPMSGEEAM
ISYEAYLKVGEKAGPKCKQFFTARVYGKLLHSDPYGRISIMQFFNYVMRKVWLHQTRIGL
SLYDVAGQGYLRESDLENYILELIPTLPQLDGLEKSFYSFYVCTAVRKFFFFLDPLRTGK
IKIQDILACSFLDDLLELRDEELSKESQESNWFSAPSALRVYGQYLNLDKDHNGMLSKEE
LSRYGTATLTAVFLDRVYQECLTYDGEMDYKTYLDFVLALENRKEPAALQYIFKLLDMEN
QGYLTVFSLNYFFRAIQEQMKIHGQEVISFQDVKDEIFDMVKPKDPYKITLQDLVNSCQG
DTVSSILIDLNGFWTYENREVLVANDNDSNSALDLDDP
Download sequence
Identical sequences ENSGMOP00000018740 ENSGMOP00000018740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]