SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000019007 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000019007
Domain Number 1 Region: 293-471
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.57e-51
Family SPRY domain 0.0009
Further Details:      
 
Domain Number 2 Region: 2-62
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000119
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 3 Region: 129-184
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000595
Family B-box zinc-binding domain 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000019007
Domain Number - Region: 179-235
Classification Level Classification E-value
Superfamily CAPPD, an extracellular domain of amyloid beta A4 protein 0.0288
Family CAPPD, an extracellular domain of amyloid beta A4 protein 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000019007   Gene: ENSGMOG00000017675   Transcript: ENSGMOT00000019467
Sequence length 473
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3765:127489:133229:1 gene:ENSGMOG00000017675 transcript:ENSGMOT00000019467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEELTCSICLSLFEIPVTISCGHNFCHDCLTSSWKESYDCPQCRAHFPTRPELKKNTVLS
NVEKFKNCSSMTEFGFEKEEEAVKKPIVMCDTCMSSEAAKTCPTCMASFCLEHVCPHLDN
PNYRAHQLREPLADMSEHICPDHHKPMEFFCVEHSRCICKLCLQQVHKGCTLKTPDNQKA
LKEESVTSRKKMLETEYQQIREMLDKEEREAMNTVDSQLQSGEDKYNNLTKSFSKNIQEM
DSIKRAISDLLSQSDILAFLQSVENLLNVNKRDQSRGRTPERKSTEDQVIDRHKLLKYAT
VLTLDPKTAHRRVKLSDDLTEASVIDVPANYPDGPARFSVCSQVLTSESFSKGRHYWEVQ
MSSNNFVAIGLSYKSMDRKGPTSRLGRNDQSWCVEWFSLKLSAWHANSETVLENLSTNRI
GVLVDCDEGTATFYSIGEKANPFHTFVFPFTQAVYPAFWIFNTSSIALCKLSG
Download sequence
Identical sequences ENSGMOP00000019007 ENSGMOP00000019007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]