SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000019031 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000019031
Domain Number 1 Region: 386-518
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.26e-37
Family SPRY domain 0.0029
Further Details:      
 
Domain Number 2 Region: 2-73
Classification Level Classification E-value
Superfamily RING/U-box 3.53e-18
Family RING finger domain, C3HC4 0.0075
Further Details:      
 
Domain Number 3 Region: 134-183
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000595
Family B-box zinc-binding domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000019031
Domain Number - Region: 93-130
Classification Level Classification E-value
Superfamily RING/U-box 0.000707
Family IBR domain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000019031   Gene: ENSGMOG00000017694   Transcript: ENSGMOT00000019491
Sequence length 518
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3765:150907:158162:1 gene:ENSGMOG00000017694 transcript:ENSGMOT00000019491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKDMEDELTCSICLSLFQCPVTISCGHNFCQDCLTSSWKESYDCPQCRAHFPTRPELKKN
TVLSTVVEKFRTRSSMTEFGLERKEEEAVKKPIVMCDTCMASEADKTCLTCMASFCLEHV
RPHHDNPNYRAHQLREPLADMSERVCPDHHKLMEFFCVQHSRCICSFCLQQVHKGCAFST
PNEQKALKESDLKSKLLSLDSKIEKTEAAIFQVTVEKNKLKESVTSRKKILEAEYQQIRE
MLDKEEREAMNTVDRKLQSGEDKYNKVTKRFSQNIQEMDNAKRGISDLLSQSATLAFLQS
VDLPSVVNAECKTPLVNLDTTDVIGAQTFIVVFKNYLCDLLKQPVAKRLTILKPGSVENL
LNVNKRDQSRGRTPTETNEDQAVDRHELLQYATVLTLDPKTAHRRVKLSDDLTEASVMDM
PANYPDGPARFSVCSQVLASKGFSRGRHYWEVQMSSNNFVGIGLSYKSMDRKGPTSRLGR
NDQSWCVEWFTLKLSAWHANSETVLESLSADRIGVLVD
Download sequence
Identical sequences ENSGMOP00000019031 ENSGMOP00000019031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]