SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000019304 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000019304
Domain Number 1 Region: 41-169
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 2.35e-54
Family N-terminal domain of cbl (N-cbl) 0.00000179
Further Details:      
 
Domain Number 2 Region: 170-255
Classification Level Classification E-value
Superfamily EF-hand 3.13e-36
Family EF-hand modules in multidomain proteins 0.0000106
Further Details:      
 
Domain Number 3 Region: 256-282
Classification Level Classification E-value
Superfamily SH2 domain 0.000000263
Family SH2 domain 0.001
Further Details:      
 
Domain Number 4 Region: 402-426
Classification Level Classification E-value
Superfamily RING/U-box 0.000006
Family RING finger domain, C3HC4 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000019304   Gene: ENSGMOG00000017936   Transcript: ENSGMOT00000019772
Sequence length 766
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4470:56250:351047:-1 gene:ENSGMOG00000017936 transcript:ENSGMOT00000019772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATALSGRNPGGRGPNRSKGRILGIIDAIQDAVGPPKQAAADRRTVEKTWKLMDKVVRLC
QNPRLQLKNSPPYILDILPDAYQHLRLILCKYEEHQKLSQLSENEYFKIYIDSLIKKSKR
AIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPGGHFQGDTFRITKADAAE
FWRRFFGDKTIVPWKVFRQCLHEVHLISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLF
QPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLHKYINKPGXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXESDGQGCPFCRCEIKGTEP
IIVDPFDPRNEGARCFFLDQFSCPALELDDEDDRLDDCLVMNGLANIRKHCAERQNSPMV
SPTSSPLSQRRKAHAAASGGGLRYGVQHLGLPPYPPLDLIQKGAGRSPSASHASPKXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPQNTSRRAGGERERGPPERPETLYQVPSS
SLCISQAPICISISAPSRXXXXXXXXXXXXXXXXXXXXXYLRFQKM
Download sequence
Identical sequences ENSGMOP00000019304 ENSGMOP00000019304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]