SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000019367 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000019367
Domain Number 1 Region: 163-221
Classification Level Classification E-value
Superfamily Homeodomain-like 3.42e-16
Family Homeodomain 0.0043
Further Details:      
 
Domain Number 2 Region: 35-99
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000536
Family LIM domain 0.016
Further Details:      
 
Domain Number 3 Region: 4-33
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000293
Family LIM domain 0.017
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000019367
Domain Number - Region: 95-122
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0295
Family LIM domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000019367   Gene: ENSGMOG00000018009   Transcript: ENSGMOT00000019837
Sequence length 350
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1484:12784:24957:-1 gene:ENSGMOG00000018009 transcript:ENSGMOT00000019837 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DMEQGKAVCAGCNCPIRDKFLLRVNGGLWHEACVRCTMCGCSLKNTCFLRDHKLYCKRDY
VDLFAVRCAGCAEAVSPVDLVMRAGLAVFHLRCFACSACSGRLQTGDRCVLRDGRLLCSR
DGYHRGRASPARSDTGXXXXXXXXXXXXRRRGGEGRPSRREELESSKRPKRPRTILTTQQ
RRAFKASFEVSSKPCRKVRETLASETGLSVRVVQVWFQNQRECVMKKLARRQQQQHDQQA
QKQQVDQPSHGTVPPCGDSTPIQELLGPSFTHIGVTGLDPHGFDLDPFRQGLTPPQMPGD
HMNPYGLYSDATEGELLCPLTDNHCLSLGASSVLTPIDRLCSMQDSYFTA
Download sequence
Identical sequences ENSGMOP00000019367 ENSGMOP00000019367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]