SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000019446 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000019446
Domain Number 1 Region: 371-540
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-49
Family SPRY domain 0.00065
Further Details:      
 
Domain Number 2 Region: 141-205
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 8.55e-16
Family B-box zinc-binding domain 0.00058
Further Details:      
 
Domain Number 3 Region: 4-59
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000188
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000019446
Domain Number - Region: 177-310
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0157
Family FCH domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000019446   Gene: ENSGMOG00000018070   Transcript: ENSGMOT00000019918
Sequence length 540
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4242:21589:26436:1 gene:ENSGMOG00000018070 transcript:ENSGMOT00000019918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTTTDHDHCHLCKESLRDPVSIPCGHVFCSICLKTYWDHTDPSGSFLCPQCRVSYHKRPT
PRRVGSSRYASLPPRSSSEAFPPPPPSPDYNYAGAQDVGCDICVGKKHKAVKSCLMCLAS
YCEKHLKPHYESATFKRHKLVDEIGHLDRQICPQHQKGLELFCKTDQMCICVLCTVKEHK
GHDMVSAEQERAEEQQRLGATQAEIQERIHDRMKQMEELKQAVDSLKSSAQQAMQECEKL
FSDMLRSIEKMQQEMSKLISSNKRAALSNAEGHMDRLTHEIADLKRRDNEITQLSRTEDH
IHFIQIRSSQRHNNNPCFLTKPLLVTAVNKMPFCQLEDKEGKRRSTIKGITTAADEVAVY
RSMPTQEPKHREDFLRFACQLTLDPNTAYRQLYLSRNNRKAALKRDPQAYGDSPARFDCL
PQVLCKEPLSGGPFYWEVDWSGEGAALGITYKGIKRTGYGDTCRIGYNRKSWSLFCSDSS
YSARHSKDQLEINAPYAPRIGVFLDHAGGTLAFYSVGDTMTLIHRFKASFSEAVYAGFWV
Download sequence
Identical sequences ENSGMOP00000019446 ENSGMOP00000019446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]