SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000020867 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000020867
Domain Number 1 Region: 10-393
Classification Level Classification E-value
Superfamily Ras GEF 3.14e-87
Family Ras GEF 0.00086
Further Details:      
 
Domain Number 2 Region: 402-458
Classification Level Classification E-value
Superfamily EF-hand 0.0000000521
Family Calmodulin-like 0.06
Further Details:      
 
Domain Number 3 Region: 464-514
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000174
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000020867   Gene: ENSGMOG00000019397   Transcript: ENSGMOT00000021377
Sequence length 532
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2236:126893:136433:1 gene:ENSGMOG00000019397 transcript:ENSGMOT00000021377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEGGLSSPRSSQLVRMTLMMHSWVVPSPVFAQKLFTLYKDCPADKRAAKRPQIRHLIRQW
INQFPVVFEADPRIEETMGDLWALVRAGGDETHSQLTDPSGLVGYPHRRSTHINISLAPS
PSVKKRKVSLLFDHMEPDEMAKHLSHLEFENFCNVSFLDYRSYVVQGTVRDNPALERSVM
MCNGVSQWVQLMILSRHTAPQRAQVFTKFIHVAQHLRSLQNFNTLMAVTGGLCHSSISRL
KDTSNLLPPDVTKALSEMTELLSSRSNYSNYRRVYGDCSGFKVPILGVHLKDLISLNEAL
PDYVQGDKINLSKLQHLYSNINELLAVHRCSPPFEANKDLLHLLTLSLDLYCTEDEIYEL
SYTKEPRNPKIQPVASVKPPVVAEWGSGVNPRLDPDTISKHVKQMVDSIMKNYDHNLDGY
ISLEDFEKISANFPFSFCTHETDRHGQISREEITSYFMRGMSVCAKLGFNFNDVHNFQET
TYKQTAFCKGCGGCVSCRMNCHKHCRALVGMECVRKHKIAPSSCLCTPDGKN
Download sequence
Identical sequences ENSGMOP00000020867 ENSGMOP00000020867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]