SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000021166 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000021166
Domain Number 1 Region: 32-143
Classification Level Classification E-value
Superfamily PH domain-like 5.45e-35
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000455
Further Details:      
 
Domain Number 2 Region: 228-302
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 5.23e-20
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00023
Further Details:      
 
Domain Number 3 Region: 402-458
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000262
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000021166   Gene: ENSGMOG00000019679   Transcript: ENSGMOT00000021684
Sequence length 472
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1609:696087:701889:-1 gene:ENSGMOG00000019679 transcript:ENSGMOT00000021684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RATATMTRGSRSAREGTHSSLLTLEENEKMEELLGRRCTAMATAVVQLYMALPHSPSVWT
LQHTGVVRFVKDNPQRSYFIRVFDLKAGVQFWEQELYSQFVYSCPRPYFHTFPADDCQVG
LSFASTQEAEIFQRVVEDKINQRNNRRGRKTQQPQSSNVSLATGRSLPPPPTNKMATVDI
QNQDVQSSPFRSMPGPLASFSTSKKGKKEKKGKNKGSKLSKRDIGAPSGFTHVSHVGWDP
NTMDPDLVKLLASAGIGEAEMKDEETSELIFNIIQQSGGMEAVKMEVNRGRQGPLPPPPG
SSPSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDSLLSQIRLGRKLKNVTEY
PETATPASAGEGEGIVGALMMVMQKRRKTIHSSDEDEGDCADDDDDDDDWDD
Download sequence
Identical sequences ENSGMOP00000021166 ENSGMOP00000021166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]