SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000021834 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000021834
Domain Number 1 Region: 21-159
Classification Level Classification E-value
Superfamily EF-hand 2.85e-22
Family Calmodulin-like 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000021834   Gene: ENSGMOG00000020345   Transcript: ENSGMOT00000022352
Sequence length 170
Comment pep:novel genescaffold:gadMor1:GeneScaffold_74:31500:32009:-1 gene:ENSGMOG00000020345 transcript:ENSGMOT00000022352 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMASALNTPAGRAGGGADRFRIATVFELCDEDQDGLLTREDLKVAVVMLFGYKPSKSETD
KLMGDQRSHTRERALTLQMFETLMTEKLSEEEPDSYVRARRVFGAFDVHRRGFLKEEDFE
AAFRTVAPLLPQRTASEAFRHADRDSDGHISFKDFEAAVGFGRTDTNPDC
Download sequence
Identical sequences ENSGMOP00000021834 ENSGMOP00000021834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]