SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for orange1.1g026508m|PACid:18118689 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g026508m|PACid:18118689
Domain Number 1 Region: 80-236
Classification Level Classification E-value
Superfamily IpsF-like 7.46e-58
Family IpsF-like 0.00000961
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) orange1.1g026508m|PACid:18118689
Sequence length 237
Sequence
MVLTMAAQSYTTTPLHRKITNKPLCPPLLSLKPRSLTAKHLRTTQSTSLPRISVSAAATS
SIEVKESSASIQPSKSKSLPFRVGHGFDLHRLEPGYPLIIGGINVPHERGCEAHSDGDVL
LHCVVDAILGALGLPDIGQIFPDSDPKWKGAPSSVFIKEAVRLMDEAGYEIGNLDATLIL
QRPKLSPYKETIRTNLSELLGADPTVVNLKAKTHEKVDSLGENRSIAAHTVILLMKK
Download sequence
Identical sequences A0A067GLX5 V4TS53
XP_006439471.1.91645 clementine0.9_020384m|PACid:19276525 orange1.1g026508m|PACid:18118689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]