SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for orange1.1g028169m|PACid:18099029 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g028169m|PACid:18099029
Domain Number 1 Region: 27-173
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 3.66e-57
Family Inorganic pyrophosphatase 0.00000958
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) orange1.1g028169m|PACid:18099029
Sequence length 212
Sequence
MSNHLGTAGSNNSGGPPVALNERILSSMSHRSVAAHPWHDLEIGPGAPAVCNCVVEIGKG
GKVKYELDKASGLIKVDRVLYSSVVYPHNYGFIPRTICEDSDPMDVLVLMQEPVLPGSFL
RCRAIGLMPMIDQGEKDDKIIAVCADDPEFRHYKDIKELPPHRLAEIRRFFEDCIHSFVF
IILSYSLIDYLSQHSAVSTTPNMHKLHCISIN
Download sequence
Identical sequences A0A067G6A9
orange1.1g028169m|PACid:18099029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]