SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for orange1.1g028755m|PACid:18103039 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g028755m|PACid:18103039
Domain Number 1 Region: 33-203
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 3.92e-67
Family Inorganic pyrophosphatase 0.00000623
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) orange1.1g028755m|PACid:18103039
Sequence length 204
Sequence
MMAPPIETSSKTPVSQPPAHPPLNERILSSMSRRSVAAHPWHDLEIGPGAPKIFNCVIEI
GKGSKVKYELDKKSGLIMVDRVLYSSVVYPHNYGFIPRTLCEDNDPLDVLIIMQEPVLPG
CFLRAKAIGLMPMIDQGEKDDKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDYKKN
ENKEVAVNDFLPASDAYNSVQQSM
Download sequence
Identical sequences A0A067D0G2 A0A2H5NYH6
orange1.1g028755m|PACid:18103039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]