SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for orange1.1g029548m|PACid:18103041 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g029548m|PACid:18103041
Domain Number 1 Region: 33-190
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 9.42e-58
Family Inorganic pyrophosphatase 0.000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) orange1.1g029548m|PACid:18103041
Sequence length 191
Sequence
MMAPPIETSSKTPVSQPPAHPPLNERILSSMSRRSVAAHPWHDLEIGPGAPKIFNCVIEI
GKGSKVDRVLYSSVVYPHNYGFIPRTLCEDNDPLDVLIIMQEPVLPGCFLRAKAIGLMPM
IDQGEKDDKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDYKKNENKEVAVNDFLPA
SDAYNSVQQSM
Download sequence
Identical sequences A0A067CZW1 A0A2H5NYI4
orange1.1g029548m|PACid:18103041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]