SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for orange1.1g030332m|PACid:18099032 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g030332m|PACid:18099032
Domain Number 1 Region: 12-174
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 5.1e-62
Family Inorganic pyrophosphatase 0.00000886
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) orange1.1g030332m|PACid:18099032
Sequence length 179
Sequence
MLYVLIFAGPGAPAVCNCVVEIGKGGKVKYELDKASGLIKVDRVLYSSVVYPHNYGFIPR
TICEDSDPMDVLVLMQEPVLPGSFLRCRAIGLMPMIDQGEKDDKIIAVCADDPEFRHYKD
IKELPPHRLAEIRRFFEDYKKNENKKVDVEDFLPAEAAIEAIKYSMDLYASYIVESLRQ
Download sequence
Identical sequences A0A067G5X3 V4RVR3
clementine0.9_023324m|PACid:19284486 orange1.1g030332m|PACid:18099032 orange1.1g030340m|PACid:18099031 XP_006425643.1.91645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]