SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for orange1.1g031908m|PACid:18103042 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g031908m|PACid:18103042
Domain Number 1 Region: 3-149
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 9.55e-60
Family Inorganic pyrophosphatase 0.0000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) orange1.1g031908m|PACid:18103042
Sequence length 150
Sequence
MQVIEIGKGSKVKYELDKKSGLIMVDRVLYSSVVYPHNYGFIPRTLCEDNDPLDVLIIMQ
EPVLPGCFLRAKAIGLMPMIDQGEKDDKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFF
EDYKKNENKEVAVNDFLPASDAYNSVQQSM
Download sequence
Identical sequences A0A067DC93
orange1.1g031908m|PACid:18103042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]