SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for orange1.1g040461m|PACid:18137372 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g040461m|PACid:18137372
Domain Number 1 Region: 66-237
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 3.01e-68
Family Inorganic pyrophosphatase 0.00000544
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) orange1.1g040461m|PACid:18137372
Sequence length 318
Sequence
MLTKILFYINSKRRFRIFCLYIIFDIPSPFTFISDSSSIFKMSEEAANVSRSAPKLNERI
LSSLSRRSVAAHPWHDLEIGPGAPNVFNCVVEITKGSKVKYELDKKTGLIKVDRVLYSSV
VYPHNYGFIPRTLCEDNDPLDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKDDKIIAVC
ADDPEYKHYTDIKELPPHRLTEIRRFFEDYKKNENKKVAVNEFLPTSTAVEAIQYSMCVR
PKLSFNFEADWAILFVYDNFQPTELFFNWQGPLCRVHYAFPEAIGEPYIPPIVFQLGGGG
MEIHHLNKSFHLCYLLST
Download sequence
Identical sequences A0A067HFJ1
orange1.1g040461m|PACid:18137372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]